compare

Comparison List

mVFP1

mVFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2010, derived from Cyphastrea microphthalma.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Cyphastrea microphthalma 25.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
491 503 80,400 0.84 67.54      

Photostability

no photostability measurements available ... add one!

mVFP1 Sequence

MNVIKPDMRIKLRMEGAVNGHKFVILGDGNGKPYEGTQTIDVTVKEGGPLPFAYDILTSAFQYGNRVFTKYPDDIADYFKQSFPVGYSWERSMTYEDGGICTVSSDIKMEGNSFIYEIRFHGLNFPSDGPVMQKKTVKWEPSTEKMYVRDGVLKGDVKMTLLLEGGGHYRCDFKSTYKAKRAVQLPDYHYIDHRIEILSHDKDYNKVKLCENAAARCSMLPSQAK

Excerpts

No excerpts have been added for mVFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change