compare

Comparison List

mTFP*

mTFP* is a basic (constitutively fluorescent) cyan fluorescent protein published in 2019, derived from Clavularia sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 25.3 kDa -

FPbase ID: 3OSEV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
468 495          

Photostability

No photostability measurements available ... add one!

mTFP* Sequence

MSGVIKPDMKIKLKMEGNVNGYAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFAYGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISLEEDSFIYEIYLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKHKLLLEGGGYYRVDFKTIYRAKKAVKLPDYHFVDHRIEILNYDKDYNKVTVYESAVARNSTD

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mTFP*
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change