compare

Comparison List

mScarlet-I3-NCwt

mScarlet-I3-NCwt is a basic (constitutively fluorescent) red fluorescent protein published in 2023, derived from synthetic construct.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

FPbase ID: 1VSM7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
567 592 102,000 0.653 66.61      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mScarlet-I3-NCwt Sequence

BLAST

mScarlet-I3-NCwt was derived from mScarlet-2A-84W with the following mutations: T74I/N99I/A105T/T128G/K140R/Y194F

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFIKHPADIPDYWKQSFPEGFKWERVMIFEDGGTVSVTQDTSLEDGTLIYKVKLRGGNFPPDGPVMQKRTMGWEASTERLYPEDVVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAFNIDRKLDITSHNEDYTVVEQYERSVARHSTGGMDELYK

Excerpts

No excerpts have been added for mScarlet-I3-NCwt
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

mScarlet3: a brilliant and fast-maturing red fluorescent protein

Gadella Twj, Van Weeren L, Stouthamer J, Hink Ma, Wolters Ahg, Giepmans Bng, Aumonier S, Dupuy J, Royant A

(2023). Nature Methods, , . doi: 10.1038/s41592-023-01809-y. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change