compare

Comparison List

mScarlet-2A-84W

mScarlet-2A-84W is a basic (constitutively fluorescent) red fluorescent protein published in 2023, derived from synthetic construct.
+
mScarlet-2A-84W Spectrum Fluorescent protein mScarlet-2A-84W excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

FPbase ID: 5CEBO

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
568 592 97,000 0.7 67.9      

Photostability

No photostability measurements available ... add one!

mScarlet-2A-84W Sequence

mScarlet-2A-84W was derived from mScarlet-2A with the following mutations: Y84W

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYWKQSFPEGFKWERVMNFEDGGAVSVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDVVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNIDRKLDITSHNEDYTVVEQYERSVARHSTGGMDELYK

Excerpts

No excerpts have been added for mScarlet-2A-84W
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change