compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mRubyFT

a.k.a. Blue-to-red fluorescent timer

This protein has unmoderated changes.

mRubyFT is a timer red fluorescent protein published in 2022, derived from synthetic construct. It has low acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	synthetic construct	26.4 kDa	-

FPbase ID: 9JNRR

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
Blue-form	408	457	26,000	0.63	16.38	3.9	342.0
Red-form	582	624	29,600	0.086	2.55	4.5	900.0

Edit States/Attributes

Edit state transitions

Photostability

No photostability measurements available ... add one!

mRubyFT Sequence

BLAST

MVSKGEELIKENMRMKVVMEGSVNGHQFKCTGEGEGNPYMGTQTMRIKVIEGGPLPFAFDILATSFLYGSRTFIKYPKGIPDFFKQSFPEGFTWERVTRYEDGGVVTVMQDTSLEDGCLVYHVQVRGVDFPSNGPVMQKKTKGWEPSTEMMYPADGGLRGYTHMALKVDGGGHLSCSFVTTYRSKKTVGNIKMPGIHAVDHRLERLEESDNEMFVVLREHSVAKFAGRGGMDELYK

Excerpts

No excerpts have been added for mRubyFT
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The mRubyFT Protein, Genetically Encoded Blue-to-Red Fluorescent Timer

Subach Om, Tashkeev A, Vlaskina Av, Petrenko De, Gaivoronskii Fa, Nikolaeva Ay, Ivashkina Oi, Anokhin Kv, Popov Vo, Boyko Km, Subach Fv

(2022). International Journal of Molecular Sciences, 23(6) , 3208. doi: 10.3390/ijms23063208. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for mRubyFT
Search RIKEN BRC for mRubyFT

Change history

Something missing or incorrect? Submit a change Submit a change