compare

Comparison List

Monomeric hyperfolder YFP

a.k.a. mhYFP

Monomeric hyperfolder YFP is a basic (constitutively fluorescent) yellow fluorescent protein published in 2022, derived from Aequorea victoria. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
Monomeric hyperfolder YFP Spectrum Fluorescent protein Monomeric hyperfolder YFP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: PF2S1

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 529 124,000 0.62 76.88 5.7 27.0  

Photostability

No photostability measurements available ... add one!

Monomeric hyperfolder YFP Sequence

Monomeric hyperfolder YFP was derived from Hyperfolder YFP with the following mutations: S147P/L195M/V206K
amino acid numbers relative to avGFP. show relative to Hyperfolder YFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKLISTTGKLPVPWPTLVTTLGYGLMVFARYPDHMKQHDFFKSAMPEGYVQERTISFEDDGYYKTRAEVKFEGDTLVNRIVLKGIDFKEDGNILGHKLEYNFNPHNVYITADKQKNGIKANFKIRHNVEDGGVQLADHYQQNTPIGDGPVLMPDNHYLSYQSKLSKDPNEKRDHMVLKERVTAAGITHDMNELYK
GenBank: OP373687

Structure

Deposited: ,
Chromophore:

Excerpts

Introducing the S147P mutation that was reported to improve thermostability in violet-light excitable uvGFP yielded hyperfolder mutants with considerable resistance to 1 M sodium hydroxide (NaOH) solutions of pH ≥ 13 (we were able to determine hyperfolder FP extinction coefficients by collecting alkaline denaturation time-course data) (Extended Data Fig. 5 and Supplementary Methods). hfYFP-S147P/V206K/L195M behaved as a stronger monomer in the OSER assay than did hfYFP (Extended Data Fig. 3d,e); the L195M mutation originated de novo from a PCR error. The V206K mutation (on β-strand 10) largely preserved the GdnHCl stability of multiple mutants (Extended Data Fig. 4d). We named the hfYFP-S147P/V206K/L195M variant ‘mhYFP’.

Campbell et al. (2022)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change