compare

Comparison List

mmilCFP

mmilCFP is a basic (constitutively fluorescent) blue fluorescent protein published in 2008, derived from Montipora millepora.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Montipora millepora 25.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
404 492 42,500 0.9 38.25      

Photostability

no photostability measurements available ... add one!

mmilCFP Sequence

MALPKQMKLTYHMEGTVNGHFFIIKGEGGGEPYEGTHTIKLQVVEGSPLPFSPDILSTVFQYGNRCFTKYPPNIVDYFKNSCSGGGYTFGRSFLYEDGAVCTASGDITLSSDKSSFEHKSKFLGVNFPADGPVMKKETTNWEPSCEKMTPNGMTLIGDVTEFLLKKDGKRYKCQFHTFHDAKEKSRNMPMPDFHFVQHEIERKDLPGPMQTWQLTEHAAACKNCFTE
GenBank: ABB17965
UniProtKB: A8CLU7
IPG: 4901536

Excerpts

No excerpts have been added for mmilCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change