compare

Comparison List

miniSOG2

miniSOG2 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2017, derived from Arabidopsis thaliana. It requires the cofactor flavin for fluorescence.
+
Oligomerization Organism Molecular Weight Cofactor
? Arabidopsis thaliana 12.4 kDa Flavin

FPbase ID: 8EDYL

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
429 507          

Photostability

No photostability measurements available ... add one!

miniSOG2 Sequence

MEKSFVITDPRLPDNPIIFASDSFLELTEYSREEILGRNPRFLRGPETDQATVQKIHDAIRDQREITVQLINYTKSGKKFWNLFRLQPIRDQKGELQYFIGVQLDG

Excerpts

No excerpts have been added for miniSOG2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change