compare

Comparison List

miniSOG Q103V

miniSOG Q103V is a basic (constitutively fluorescent) cyan fluorescent protein published in 2016, derived from Arabidopsis thaliana. It requires the cofactor flavin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Arabidopsis thaliana 12.3 kDa Flavin

FPbase ID: G4TXA

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
440 487 0.43        
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

miniSOG Q103V Sequence

BLAST
MEKSFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNGRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLLHLQPMRDQKGELQYFIGVVLDG

Excerpts

No excerpts have been added for miniSOG Q103V
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Assessing the potential of photosensitizing flavoproteins as tags for correlative microscopy

Rodríguez-Pulido A, Cortajarena Al, Torra J, Ruiz-González R, Nonell S, Flors C

(2016). Chemical Communications, 52(54) , 8405-8408. doi: 10.1039/c6cc03119f. Article   Pubmed

Additional References

  1. Fluorescent Flavoprotein Heterodimers: Combining Photostability with Singlet Oxygen Generation

    Rodríguez-Pulido A, Torra J, Mejías Sh, Cortajarena Al, Ruiz-González R, Nonell S, Flors C

    (2018). ChemPhotoChem, 2(7) , 571-574. doi: 10.1002/cptc.201800002. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change