compare

Comparison List

miniGFP2

miniGFP2 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2022, derived from Arabidopsis thaliana. It has low acid sensitivity. It requires the cofactor flavin for fluorescence.
+
Oligomerization Organism Molecular Weight Cofactor
? Arabidopsis thaliana 12.6 kDa Flavin

FPbase ID: UVP48

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
450 499 16,200 0.32 5.18 4.4   4.54

Photostability

No photostability measurements available ... add one!

miniGFP2 Sequence

MEKSFVITDPWLPDYPIISASDGFLELTEYSRDEIMGRNARFLQGPETDQATVQKIRDAIRDRRPTTVQLINYTKSGKKFWNLLHLQPVFDGKGGLQYFIGVQLVGSDHV

Excerpts

No excerpts have been added for miniGFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Enhanced small green fluorescent proteins as a multisensing platform for biosensor development

Liang G-T, Lai C, Yue Z, Zhang H, Li D, Chen Z, Lu X, Tao L, Subach Fv, Piatkevich Kd

(2022). Frontiers in Bioengineering and Biotechnology, 10, . doi: 10.3389/fbioe.2022.1039317. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change