compare

Comparison List

mGold2t

mGold2t is a basic (constitutively fluorescent) yellow fluorescent protein published in 2025, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.
+
mGold2t Spectrum Fluorescent protein mGold2t excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: HUE6V

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 527 126,000 0.7 88.2 5.4 13.1 2.95

Photostability

No photostability measurements available ... add one!

mGold2t Sequence

mGold2t was derived from mGold2s with the following mutations: S205T
amino acid numbers relative to avGFP. show relative to mGold2s

MASKGEELFTGVVPILVELDGDINGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTSLGYGLQCFARYPDNMKRHDFFKSAMPEGYVQERTIFFEDDGNYKTRAEVKFEGGTLVNRVELKGIDFKEDGNILGHKLEYNYNCHNVFITADRQQNGIKVNFKIRHNIEVGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQTKLSKDPNEKRDHMVLLEFVTAAGITLSMDELYK
GenBank: PP826966

Excerpts

No excerpts have been added for mGold2t
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change