compare

Comparison List

mGold2s

mGold2s is a basic (constitutively fluorescent) yellow fluorescent protein published in 2025, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.
+
mGold2s Spectrum Fluorescent protein mGold2s excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: CGRMD

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
517 529 131,000 0.69 90.39 5.1 14.8 3.04
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mGold2s Sequence

BLAST

mGold2s was derived from mGold with the following mutations: V1aA/V22I/H77N/Q80R/K101E/D117G/I123V/S147C/Y151F/K156R/K158Q/A163V/D173V/G232S
amino acid numbers relative to avGFP. show relative to mGold

MASKGEELFTGVVPILVELDGDINGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTSLGYGLQCFARYPDNMKRHDFFKSAMPEGYVQERTIFFEDDGNYKTRAEVKFEGGTLVNRVELKGIDFKEDGNILGHKLEYNYNCHNVFITADRQQNGIKVNFKIRHNIEVGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLSMDELYK
GenBank: PP826965

Excerpts

No excerpts have been added for mGold2s
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Bright and photostable yellow fluorescent proteins for extended imaging

Lee J, Lai S, Yang S, Zhao S, Blanco Fa, Lyons Ac, Merino-Urteaga R, Ahrens Jf, Nguyen Na, Liu H, Liu Z, Lambert Gg, Shaner Nc, Chen L, Tolias Kf, Zhang J, Ha T, St-Pierre F

(2025). Nature Communications, 16(1) , 3241. doi: 10.1038/s41467-025-58223-5. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change