compare

Comparison List

meleRFP

meleRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Mycedium elephantotus.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Mycedium elephantotus 25.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
573 579 45,600 0.85 38.76      

Photostability

no photostability measurements available ... add one!

meleRFP Sequence

MSVIKPDMKLKLRMEGTVNGHYFVIEGDGKGRPFEGKQSMDLDVKEGGPLPFAYDILTTAFHYGNRVFAEYPDHIPDYFKQSFPGGYSWERSLTFEDGGICIARNDIKMVGDTFYNTVRFDGVNFPPNGPVMQRRTQKWEPSTEKIYVRDGVLTGDITMALLLEGGVHYRCDFRTTYKAKEKGVQLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNKRQ
GenBank: ABB17959
UniProtKB: A8CLR7
IPG: 4901479

Excerpts

No excerpts have been added for meleRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change