compare

Comparison List

meffGFP

meffGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Montipora efflorescens.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Montipora efflorescens 26.5 kDa -

FPbase ID: N6WUS

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
492 506 92,000 0.58 53.36      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

meffGFP Sequence

BLAST
MALSKNGVKDRMKLKFHMEGSVNGHEFTIKGEGTGQPYEGTQSIQLRVEKGGPLPFSVDILSAVFLYGNRVFTKYPQDLVDYFKNSCPAGYTWQRSFLFEDGAVCTASADITVSVEENCFYHESKFHGVNFPADGPVMKKMTTNWEPSCEKITPIPNEGILKGDVTMFLLLKDGGRYRCQFDTVYKAKSDPKTIMMPDWHFIQHKLNREDRSDAKHQKWRLVENAIAYRSTLS
GenBank: ABB17966
UniProtKB: A8CLV1
IPG: 4901566

Excerpts

No excerpts have been added for meffGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and Evolution of Coral Fluorescent Proteins

Alieva No, Konzen Ka, Field Sf, Meleshkevitch Ea, Hunt Me, Beltran-Ramirez V, Miller Dj, Wiedenmann J, Salih A, Matz Mv

(2008). PLoS ONE, 3(7) , e2680. doi: 10.1371/journal.pone.0002680. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change