compare

Comparison List

meffCP

meffCP is a fluorescent protein published in 2008, derived from Montipora efflorescens. It is reported to be a tetramer.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Montipora efflorescens 25.0 kDa -

FPbase ID: C7XMS

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
574   118,300          

Photostability

No photostability measurements available ... add one!

meffCP Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPLSQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYNVKISGVNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGYYLCEFKSTYKAKKPVRMPGYHYVDRKLDVTSHNKDYTFVEQCEISIARHSLLG
GenBank: ABB17950
UniProtKB: A8CLM1
IPG: 4901553

Excerpts

No excerpts have been added for meffCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change