compare

Comparison List

mcRFP

mcRFP is a fluorescent protein published in 2004, derived from Montastraea cavernosa.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 25.9 kDa -

FPbase ID: X26SE

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mcRFP Sequence

BLAST
MSVIKSVMKIKRRMEGSVNGHNFVIVGEGEGKPYEGTQSMDLTVKEGAPLPFAYDIMTTVFHYGNRVFAKYPKHIPDYFKQMFPEGYSWERSMNFEDGGICIARNEITMEGDCFFNKVRFDGVNFPPNGPVMQKKTLKWEPSTEKMYVRDGVLTGDINMALLLEGGGHYRCDFRTTYRAKKKGVKLPDYHFVDHSIEILRHDKEYTEVKLYEHAEAHSGLPRVAK
GenBank: AAQ90465
UniProtKB: Q6USK3
IPG: 1831942

Excerpts

No excerpts have been added for mcRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Biophysical characterization of natural and mutant fluorescent proteins cloned from zooxanthellate corals

Sun Y, Castner Ew, Lawson Cl, Falkowski Pg

(2004). FEBS Letters, 570(1-3) , 175-183. doi: 10.1016/j.febslet.2004.06.043. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change