compare

Comparison List

mCerulean2.D3

mCerulean2.D3 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2011, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: 9KYTB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 472 45,000 0.52 23.4      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mCerulean2.D3 Sequence

BLAST

mCerulean2.D3 was derived from mCerulean2 with the following mutations: A146D/I147F

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNDFHGNVYITADKQKNGIKANFGLNCNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mCerulean2.D3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An Improved Cerulean Fluorescent Protein with Enhanced Brightness and Reduced Reversible Photoswitching

Markwardt Ml, Kremers G-J, Kraft Ca, Ray K, Cranfill Pjc, Wilson Ka, Day Rn, Wachter Rm, Davidson Mw, Rizzo Ma

(2011). PLoS ONE, 6(3) , e17896. doi: 10.1371/journal.pone.0017896. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change