compare

Comparison List

mcavFP

mcavFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2003, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 25.8 kDa -

FPbase ID: SF8MO

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
440 510          

Photostability

No photostability measurements available ... add one!

mcavFP Sequence

MSVIKPIMEIKLRMQGVVNGHKFVIKGEGEGKPFEGTQTINLTVKEGAPLPFAYDILTSAFQYGNRVFTKYPDDIPDYFKQTFPEGYSWERIMAYEDQSICTATSDIKMEGDCFIYEIQFHGVNFPPNGPVMQKKTLKWEPSTEKMYVRDGVLKGDVNMALLLEGGGHYRCDFRSTYKAKKRVQLPDYHFVDHRIEILSHDNDYNTVKLSEDAEARYSMLPSQAK
GenBank: AAK62982
UniProtKB: Q963F5
IPG: 190667

Excerpts

No excerpts have been added for mcavFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Green-fluorescent proteins in Caribbean corals

Mazel Ch, Lesser Mp, Gorbunov My, Barry Tm, Farrell Jh, Wyman Kd, Falkowski Pg

(2003). Limnology and Oceanography, 48(1part2) , 402-411. doi: 10.4319/lo.2003.48.1_part_2.0402. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change