compare

Comparison List

McaG1ea

McaG1ea is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 26.0 kDa -

FPbase ID: JF6E7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
492 514          

Photostability

No photostability measurements available ... add one!

McaG1ea Sequence

MSVIKPDMKIKLRMEGAVNGHKFVIEGDGKGKPFEGKQTMDLTVIEGAPLPFAYDILTTVFDYGNRVFAKYPKDIPDYFKQTFPEGYSWERSMTYEDQGICIATNDITMMKGVDDCFVYKIRFDGVNFPANGPVMQRKTLKWEPSTEKMYVRDGVLKGDVNMALLLEGGGHYRCDSKTTYKAKKVVQLPDYHFVDHRIEIGSPDKDYNKVKLYEHAEAHFGLPRQAK
GenBank: AAU04447
UniProtKB: Q66ND4
IPG: 3612568

Excerpts

No excerpts have been added for McaG1ea
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cloning of anthozoan fluorescent protein genes

Carter Rw, Schmale Mc, Gibbs Pdl

(2004). Comparative Biochemistry and Physiology Part C: Toxicology & Pharmacology, 138(3) , 259-270. doi: 10.1016/j.cca.2004.07.002. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change