compare

Comparison List

mc4

mc4 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2003, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 26.1 kDa -

FPbase ID: Q7SKD

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
505 515          

Photostability

No photostability measurements available ... add one!

mc4 Sequence

MSVIKPDMKIKLRMEGAVNGHKFVIEGDGKGKPFEGKQTMDLTVIEGAPLPFAYDILTTVFDYGNRVFAKYPKDIPDYFKQTFPEGYSWERSMTYEDQGICIATNDITMMKGVDDCFLYKIRFDGVNFPANGPVMQRKTLKWEPSTEKMYVRDGVLKGDVNMALLLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHRIEIVSHDKDYNKVKLYEHAEAHSGLPRQAK
GenBank: AAO61601
UniProtKB: Q7Z0W6
IPG: 1678543

Excerpts

No excerpts have been added for mc4
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change