compare

Comparison List

mc1

mc1 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2003, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Montastraea cavernosa 25.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
508 582          

Photostability

no photostability measurements available ... add one!

mc1 Sequence

MSVIKSVMKIKLRMEGSVNGHNFVIVGEGEGKPYEGTQSMDLTVKEGAPLPFAYDIMTTVFHYGNRVFAKYPKHIPDYFKQMFPEGYSWERSMNFEDGGICTARNEITMEGDCFFNKVRFDGVNFPPNGPVMQKKTLKWEPSTEKMYVRDGVLTGDINMALLLEGGGHYRCDFRTTYRAKKKGVKLPDYHFVDHSIEILRHDKEYTEVKLYEHAEAHSGLPRVAK
GenBank: AAO61598
UniProtKB: Q7Z0W9
IPG: 1678988

Excerpts

No excerpts have been added for mc1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change