compare

Comparison List

M355NA

M355NA is a basic (constitutively fluorescent) red fluorescent protein published in 2003, derived from Anemonia sulcata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Anemonia sulcata 25.9 kDa -

FPbase ID: PO1ML

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
572 595 220,000 0.21 46.2      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

M355NA Sequence

BLAST
MASFLTETMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSCMYGSKTFIKYVSGIPDYFKQSFPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKAGRWEPCTEIVYEVDGVLRGQSLMALKCPGGRHLTCHLHTTYRSKKPASALKMPGFHFEDHRIEIMEEVEKGKCYKQYEAAVGRYCDAAPSKLGHN

Excerpts

No excerpts have been added for M355NA
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Hetero-oligomeric tagging diminishes non-specific aggregation of target proteins fused with Anthozoa fluorescent proteins

Bulina Me, Verkhusha Vv, Staroverov Db, Chudakov Dm, Lukyanov Ka

(2003). Biochemical Journal, 371(1) , 109-114. doi: 10.1042/bj20021796. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change