compare

Comparison List

M355NA

M355NA is a basic (constitutively fluorescent) red fluorescent protein published in 2003, derived from Anemonia sulcata.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Anemonia sulcata 25.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
572 595 220,000 0.21 46.2      

Photostability

no photostability measurements available ... add one!

M355NA Sequence

MASFLTETMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSCMYGSKTFIKYVSGIPDYFKQSFPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKAGRWEPCTEIVYEVDGVLRGQSLMALKCPGGRHLTCHLHTTYRSKKPASALKMPGFHFEDHRIEIMEEVEKGKCYKQYEAAVGRYCDAAPSKLGHN

Excerpts

No excerpts have been added for M355NA
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change