compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Lime

This protein has unmoderated changes.

Lime is a multistate green fluorescent protein published in 2023, derived from Aequorea victoria. It has high acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.9 kDa	-

FPbase ID: BJRSJ

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
488	510	45,000	0.77	34.65	7.1

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Lime Sequence

BLAST

Lime was derived from superecliptic pHluorin with the following mutations: M1_S2insV/S30R/Y39N/C48S/C70S/F99S/N105T/Y145F/M153T/I171V/G175S M1_S2insV/S30R/Y39N/C48S/C70S/F99S/N105T/Y145F/M153T/I171V/G175S

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFISTTGKLPVPWPTLVTTLTYGVQSFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNDHQVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLFTTSTLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for Lime
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational Engineering of an Improved Genetically Encoded pH Sensor Based on Superecliptic pHluorin

Shen Y, Wen Y, Sposini S, Vishwanath Aa, Abdelfattah As, Schreiter Er, Lemieux Mj, De Juan-Sanz J, Perrais D, Campbell Re

(2023). ACS Sensors, 8(8) , 3014-3022. doi: 10.1021/acssensors.3c00484. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for Lime
Search RIKEN BRC for Lime

Change history

Something missing or incorrect? Submit a change Submit a change