compare

Comparison List

LEA

LEA is a fluorescent protein published in 2013, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Montastraea cavernosa 26.4 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

LEA Sequence

MSVIKSDMKIKLRMEGTVNGHKFVIEGEGEGKPYEGTQTMNLKVKEGAPLPFAYDILTTVFHYGNRVFAKYPKHIPDYFKQSFPEGYSWERSMTFEDGGICTARNDITLEGDCFFNEIRFDGVNFPPNGPVMQKKTLKWEPSTEKMYVRDGVLTGDINMALLLEGGGHYRCDFKTTYKAKKGVQLPDYHFVDHCIEILSHDKDYNNVKLYEHAVAHSGLPRQAKHHHHHH

Structure

Deposited: ,
Chromophore (HYG):

Excerpts

No excerpts have been added for LEA
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change