compare

Comparison List

LanFP2

LanFP2 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Branchiostoma floridae.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Branchiostoma floridae 23.7 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
500 516 162,000 0.13 21.06      

Photostability

no photostability measurements available ... add one!

LanFP2 Sequence

MSLPTTHDLHIFGSVNGAEFDLVGGGKGNPNDGTLETSVKSTRGALPCSPLLIGPNLGYGFYQYLPFPGGASPFQTAITDGGYQVHRVFKFEDGGVLSCNFRYTYEGGKIKGEFQLIGSGFPAGGPVMSGGLTTLDRSVAKLQCSDDCTITGTNNWSFCTTDGKRHQADVQTNYTFAKPLPAGLKEKMPIFLGHQIEVKASKTEITLSEKVKAFIDTVGSGTG

Excerpts

No excerpts have been added for LanFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change