compare

Comparison List

laesGFP

laesGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Labidocera aestiva.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Labidocera aestiva 24.9 kDa -

FPbase ID: 7YHAN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
491 506          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

laesGFP Sequence

BLAST
MPVMKIECRISGTMNGEEFELVGAGDGNTDEGRMTNKMKSTKGPLSFSPYLLSHIMGYGFYHYATFPAGYENVYLHAAKNGGYTNTRTERYEDGGIISVNFTYRYEGNKVIGDFKVVGSGFPANSVIFTDKIIKSNPTCEHIYPKGDNILVNAYTRTWMLRDGGYYSAQVNNHLHFKTAMHPTMLQNGGSMFTYRKVEELHSQSDVGIVEYQHVFKTPTAFA
GenBank: AAQ01185
UniProtKB: Q6WV11
IPG: 1715857

Excerpts

No excerpts have been added for laesGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

GFP-like Proteins as Ubiquitous Metazoan Superfamily: Evolution of Functional Features and Structural Complexity

Shagin Da, Barsova Ev, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Labas Ya, Semenova Tn, Ugalde Ja, Meyers A, Nunez Jm, Widder Ea, Lukyanov Sa, Matz Mv

(2004). Molecular Biology and Evolution, 21(5) , 841-850. doi: 10.1093/molbev/msh079. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change