compare

Comparison List

laesGFP

laesGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Labidocera aestiva.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Labidocera aestiva 24.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
491 506          

Photostability

no photostability measurements available ... add one!

laesGFP Sequence

MPVMKIECRISGTMNGEEFELVGAGDGNTDEGRMTNKMKSTKGPLSFSPYLLSHIMGYGFYHYATFPAGYENVYLHAAKNGGYTNTRTERYEDGGIISVNFTYRYEGNKVIGDFKVVGSGFPANSVIFTDKIIKSNPTCEHIYPKGDNILVNAYTRTWMLRDGGYYSAQVNNHLHFKTAMHPTMLQNGGSMFTYRKVEELHSQSDVGIVEYQHVFKTPTAFA
GenBank: AAQ01185
UniProtKB: Q6WV11
IPG: 1715857

Excerpts

No excerpts have been added for laesGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change