compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

iLov

a.k.a. 981

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Jul 23, 2018 19:41:03. Or view the full change history

iLov is a multistate cyan fluorescent protein published in 2008, derived from Broad host range vector vector pCVD060. It requires the cofactor flavin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	Broad host range vector vector pCVD060	14.3 kDa	Flavin

FPbase ID: CE7VU

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
default	447	497		0.44
Dark

Edit States/Attributes

Transitions

From	To	Switch λ
default	Dark	476

Edit state transitions

Photostability

No photostability measurements available ... add one!

iLov Sequence

BLAST

MIEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHVSGGGGSDYKDDDDK

GenBank: AII99665

IPG: 61191410

Excerpts

No excerpts have been added for iLov
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The photoreversible fluorescent protein iLOV outperforms GFP as a reporter of plant virus infection

Chapman S, Faulkner C, Kaiserli E, Garcia-Mata C, Savenkov Ei, Roberts Ag, Oparka Kj, Christie Jm

(2008). Proceedings of the National Academy of Sciences, 105(50) , 20038-20043. doi: 10.1073/pnas.0807551105. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for iLov
Search RIKEN BRC for iLov

Change history

Something missing or incorrect? Submit a change Submit a change