compare

Comparison List

iLov

a.k.a. 981

iLov is a basic (constitutively fluorescent) cyan fluorescent protein published in 2008, derived from Broad host range vector vector pCVD060. It requires the cofactor flavin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Broad host range vector vector pCVD060 14.3 kDa Flavin

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
447 497 0.44        

Photostability

no photostability measurements available ... add one!

iLov Sequence

MIEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHVSGGGGSDYKDDDDK
GenBank: AII99665
IPG: 61191410

Excerpts

No excerpts have been added for iLov
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The photoreversible fluorescent protein iLOV outperforms GFP as a reporter of plant virus infection

Chapman S, Faulkner C, Kaiserli E, Garcia-Mata C, Savenkov Ei, Roberts Ag, Oparka Kj, Christie Jm

(2008). Proceedings of the National Academy of Sciences, 105(50) , 20038-20043. doi: 10.1073/pnas.0807551105. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change