compare

Comparison List

iLov

a.k.a. 981

iLov is a multistate cyan fluorescent protein published in 2008, derived from Broad host range vector vector pCVD060. It requires the cofactor flavin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Broad host range vector vector pCVD060 14.3 kDa Flavin

FPbase ID: CE7VU

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Dark              
default 447 497 0.44        

Transitions

From To Switch λ
default Dark 476

Photostability

No photostability measurements available ... add one!

iLov Sequence

MIEKNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFIGVQLDGSDHVSGGGGSDYKDDDDK
GenBank: AII99665
IPG: 61191410

Excerpts

No excerpts have been added for iLov
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The photoreversible fluorescent protein iLOV outperforms GFP as a reporter of plant virus infection

Chapman S, Faulkner C, Kaiserli E, Garcia-Mata C, Savenkov Ei, Roberts Ag, Oparka Kj, Christie Jm

(2008). Proceedings of the National Academy of Sciences, 105(50) , 20038-20043. doi: 10.1073/pnas.0807551105. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change