compare

Comparison List

HriGFP

HriGFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2014, derived from Hydnophora rigida.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Hydnophora rigida 15.7 kDa -

FPbase ID: XBY8K

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
507 527          

Photostability

No photostability measurements available ... add one!

HriGFP Sequence

MPRISDKLMKTRWRGFHSIPSIPPDLGGIYGIGEKTSRRKTTEHLYTGRAKDIKSRLMKHKYGHQAIDRKIRSNIKQKKLSDLRFKFVEERNHKAKEGLAIEGLKKKLGYAPRFNLRKRGWIKAKEKPRPQKEG
GenBank: ABZ11026
UniProtKB: B0ZZ77
IPG: 14277909

Excerpts

No excerpts have been added for HriGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Novel fluorescent protein from Hydnophora rigida possesses green emission

Idrees M, Thangavelu K, Sikaroodi M, Smith C, Sivaraman J, Gillevet Pm, Bokhari H

(2014). Biochemical and Biophysical Research Communications, 448(1) , 33-38. doi: 10.1016/j.bbrc.2014.04.042. Article   Pubmed

Additional References

  1. Novel fluorescent protein from Hydnophora rigida possess cyano emission

    Bokhari H, Smith C, Veerendra K, Sivaraman J, Sikaroodi M, Gillevet P

    (2010). Biochemical and Biophysical Research Communications, 396(3) , 631-636. doi: 10.1016/j.bbrc.2010.04.136. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change