compare

Comparison List

HriCFP

HriCFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2010, derived from Hydnophora rigida.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Hydnophora rigida 15.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
450 495          

Photostability

no photostability measurements available ... add one!

HriCFP Sequence

MPRISDKLMKTRWRGFHSIPSIPPDLGGIYGIGEKTSRRKTTEHLYTGRAKDIKSRLMKHKYGHQAIDRKIRSNIKQKKLSDLRFKFVEERNHKAKEGLAIEGLKKKLGYAPRFNLRKGDGLRPRKSQDHKKKG
GenBank: ABZ11027
UniProtKB: B0ZZ78
IPG: 14277910

Excerpts

No excerpts have been added for HriCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Novel fluorescent protein from Hydnophora rigida possess cyano emission

Bokhari H, Smith C, Veerendra K, Sivaraman J, Sikaroodi M, Gillevet P

(2010). Biochemical and Biophysical Research Communications, 396(3) , 631-636. doi: 10.1016/j.bbrc.2010.04.136. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change