compare

Comparison List

hmGFP

hmGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2003, derived from Heteractis magnifica.
+
hmGFP Spectrum Fluorescent protein hmGFP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Heteractis magnifica 25.9 kDa -

FPbase ID: EKYG9

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
490 510          

Photostability

No photostability measurements available ... add one!

hmGFP Sequence

MYSYIKETMRSKVYMEGNVNNHAFKCTAEGEGKPYKGSQKLTITVTEGGPLPFAFDILSHAFQYGNKVFTKYPDDIPDFFKQSLSGGFTWKRVSNYEDGGVLTVDQKTSLEGDCIICNIKVHGTNFPADGPVMQKQTNGWEPSTETVIPRGEGILLRDVPALKLRNNKGHLLCVMETTYKPNKRVNLPKLHFHHLRMEKDSISDDEKTIKQHEDVRASYFNVRFDESS
GenBank: AAO16871
UniProtKB: Q86LV4
IPG: 94639

Excerpts

No excerpts have been added for hmGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A naturally enhanced green fluorescent protein from magnificent sea anemone (Heteractis magnifica) and its functional analysis

Tu H, Xiong Q, Zhen S, Zhong X, Peng L, Chen H, Jiang X, Liu W, Yang W, Wei J, Dong M, Wu W, Xu A

(2003). Biochemical and Biophysical Research Communications, 301(4) , 879-885. doi: 10.1016/s0006-291x(03)00019-6. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change