compare

Comparison List

hcriGFP

hcriGFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2002, derived from Heteractis crispa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Heteractis crispa 25.3 kDa -

FPbase ID: C5398

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
405 500          

Photostability

No photostability measurements available ... add one!

hcriGFP Sequence

MCSYIKETMQSKVYMEGKVNDHNFKCTAEGKGEPYKGSQSLTITVTEGGPLPFAFDILSHAFRYGNKVFAKYPKDHPDFFKQSLPEGFTWERVSNYEDGGVLTVKQETSLEGDCIICKIKAHGTNFPADGPVMQKRTNGWEPSTETVIPRGGGILMRDVPALKLLGNKGHLLCVMETTYKSKKKVNLPKPHFHHLRMEKDSVSDDEKTIEQHENVRASYFNDSGK
GenBank: AAM10626
UniProtKB: Q8T6T9
IPG: 3493082

Excerpts

No excerpts have been added for hcriGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change