compare

Comparison List

HcRed7

HcRed7 is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Heteractis crispa.
+
HcRed7 Spectrum Fluorescent protein HcRed7 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Dimer Heteractis crispa 25.7 kDa -

FPbase ID: LNY1F

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
592 645 75,000 0.08 6.0      

Photostability

No photostability measurements available ... add one!

HcRed7 Sequence

HcRed7 was derived from HcRed with the following mutations: R67K/I196Y

MAGLLKESMRIKMYMEGTVNGHYFKCEGEGDGNPFAGTQSMRIHVTEGAPLPFAFDILAPCCEYGSKTFVHHTAEIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVHGTNFPADGPVMKNKSGGWEPSTEVVYPENGVLCGRNVMALKVGDRHLICHHYTSYRSKKAVRALTMPGFHFTDYRLQMLRKKKDEYFELYEASVARYSDLPEKAN

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for HcRed7
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Monomerization of far-red fluorescent proteins

Wannier Tm, Gillespie Sk, Hutchins N, Mcisaac Rs, Wu S-Y, Shen Y, Campbell Re, Brown Ks, Mayo Sl

(2018). Proceedings of the National Academy of Sciences, 115(48) , E11294-E11301. doi: 10.1073/pnas.1807449115. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change