compare

Comparison List

HcRed-Tandem

a.k.a. t-HcRed

HcRed-Tandem is a basic (constitutively fluorescent) red fluorescent protein published in 2002, derived from Heteractis crispa.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tandem dimer Heteractis crispa 25.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
590 637 160,000 0.04 6.4      

Photostability

no photostability measurements available ... add one!

HcRed-Tandem Sequence

RSPGMSGLLKESMRIKMYMEGTVNGHYFKCEGEGDGNPFAGTQGMRIHVTEGAPLPFAFDILAPCCAYGSRTFVHHTAEIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVHGTNFPADGPVMKNESGGWEPSTEVVYPENGVLCGRNVMALKVGDRHLICHLYTSYKSKKAVRALTMPGFHFTDIRLQMLRKKKDEYFELYEASVARYSDLPEKAN

Excerpts

No excerpts have been added for HcRed-Tandem
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change