compare

Comparison List

GFPxm163

GFPxm163 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2006, derived from Aequorea macrodactyla.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea macrodactyla 27.0 kDa -

FPbase ID: 5M9ZL

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
512 523 1.0        

Photostability

No photostability measurements available ... add one!

GFPxm163 Sequence

MSKGEELFTGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLGYGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIFFQDDGKYKTRGEVKFEGDTLVNRIELKGMDFKEDGNILGHKLEYNFNSHNVYIMPDKANNGLKVNFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSYQTAISKDRNETRDHMVFLEFFSACGHTHGMDELYK
GenBank: AAL33914
UniProtKB: Q8WTC8
IPG: 1124407

Excerpts

No excerpts have been added for GFPxm163
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Variants of Green Fluorescent Protein GFPxm

Luo W-X, Cheng T, Guan B-Q, Li S-W, Miao J, Zhang J, Xia N-S

(2006). Marine Biotechnology, 8(5) , 560-566. doi: 10.1007/s10126-006-6006-8. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change