compare

Comparison List

GFPxm162

GFPxm162 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2006, derived from Aequorea macrodactyla.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea macrodactyla 27.0 kDa -

FPbase ID: PHV2M

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
514 525          

Photostability

No photostability measurements available ... add one!

GFPxm162 Sequence

MSKGEELFTGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLGYGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIFFQDDGKYKTRGEVKFEGDTLVNRIELKGMDFKEDGNILGHKLEYNFNSHNVYIMPDKANNGLKVNFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSFQTAISKDRNETRDHMVFLEFFSACGHTHGMDELYK
GenBank: AAL33913
UniProtKB: Q8WTC9
IPG: 978703

Excerpts

No excerpts have been added for GFPxm162
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Variants of Green Fluorescent Protein GFPxm

Luo W-X, Cheng T, Guan B-Q, Li S-W, Miao J, Zhang J, Xia N-S

(2006). Marine Biotechnology, 8(5) , 560-566. doi: 10.1007/s10126-006-6006-8. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change