compare

Comparison List

GFPxm161

GFPxm161 is a basic (constitutively fluorescent) green fluorescent protein published in 2006, derived from Aequorea macrodactyla.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea macrodactyla 27.0 kDa -

FPbase ID: PK2PN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
500 510          

Photostability

No photostability measurements available ... add one!

GFPxm161 Sequence

MSKGEELFTGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLGYGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIFFQDDGKYKTRGEVKFEGDTLVNRIELKGMDFKEDGNILGHKLEYNFNSHNVYIMPDKANNGLKVNFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSLQTAISKDRNETRDHMVFLEFFSACGHTHGMDELYK
GenBank: AAL33912
UniProtKB: Q8WTD0
IPG: 665233

Excerpts

No excerpts have been added for GFPxm161
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Variants of Green Fluorescent Protein GFPxm

Luo W-X, Cheng T, Guan B-Q, Li S-W, Miao J, Zhang J, Xia N-S

(2006). Marine Biotechnology, 8(5) , 560-566. doi: 10.1007/s10126-006-6006-8. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change