compare

Comparison List

GFPxm16

GFPxm16 is a basic (constitutively fluorescent) green fluorescent protein published in 2006, derived from Aequorea macrodactyla.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea macrodactyla 27.0 kDa -

FPbase ID: 7XQBJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
485 504 0.74        

Photostability

No photostability measurements available ... add one!

GFPxm16 Sequence

MSKGEELFTGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLGYGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIFFQDDGKYKTRGEVKFEGDTLVNRIELKGMDFKEDGNILGHKLEYNFNSHNVYIMPDKANNGLKVNFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSTQTAISKDRNETRDHMVFLEFFSACGHTHGMDELYK
GenBank: AAK02063
IPG: 1087995

Excerpts

No excerpts have been added for GFPxm16
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Variants of Green Fluorescent Protein GFPxm

Luo W-X, Cheng T, Guan B-Q, Li S-W, Miao J, Zhang J, Xia N-S

(2006). Marine Biotechnology, 8(5) , 560-566. doi: 10.1007/s10126-006-6006-8. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change