compare

Comparison List

GFP-151pyTyrCu

GFP-151pyTyrCu is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2012, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.4 kDa -

FPbase ID: L1JAY

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
375 510          

Photostability

No photostability measurements available ... add one!

GFP-151pyTyrCu Sequence

MSKGAELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKAHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIALKGIDFKEAGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIADGSVQLADHYQQNTPIGAGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDEAYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for GFP-151pyTyrCu
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Genetic Incorporation of a Metal-Chelating Amino Acid as a Probe for Protein Electron Transfer

Liu X, Li J, Dong J, Hu C, Gong W, Wang J

(2012). Angewandte Chemie International Edition, 51(41) , 10261-10265. doi: 10.1002/anie.201204962. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change