compare

Comparison List

gdjiCP

gdjiCP is a fluorescent protein published in 2008, derived from Goniopora djiboutiensis. It is reported to be a tetramer.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Goniopora djiboutiensis 24.8 kDa -

FPbase ID: 2BECV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
583   110,300          

Photostability

No photostability measurements available ... add one!

gdjiCP Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVQGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPQAQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYNVKFSGLNFPPSGPVMQKKTQGWEPNTERLLARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVKMPGYHFVDRKLDVTNHNQDYTSVEQCEISIARKPVVA
GenBank: ABB17949
UniProtKB: A8CLL3
IPG: 4901481

Excerpts

No excerpts have been added for gdjiCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change