compare

Comparison List

fuGFP

fuGFP is a basic (constitutively fluorescent) fluorescent protein published in 2024.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? <add one> 27.1 kDa -

FPbase ID: JLSC6

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

fuGFP Sequence

BLAST
MVSSGEDIFSGLVPILIELEGDVNGHRFSVRGEGYGDASNGKLEIKFICTTGRLPVPWPTLVTTLSYGVQCFAKYPEHMRQNDFFKSAMPDGYVQERTISFKEDGTYKTRAEVKFEGEALVNRIDLKGLEFKEDGNILGHKLEYSFNSHYVYITADKNRNGLEAQFRIRHNVDDGSVQLADHYQQNTPIGEGPVLLPEQHYLTTNSVLSKDPQERRDHMVLVEFVTAAGLSLGMDELYKS

Excerpts

No excerpts have been added for fuGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Development of a whole‐cell biosensor for ethylene oxide and ethylene

Moratti Cf, Yang Snn, Scott C, Coleman Nv

(2024). Microbial Biotechnology, 17(6) , e14511. doi: 10.1111/1751-7915.14511. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change