compare

Comparison List

The URL /protein/fugfp/ was not found. You have been forwarded here

Free Use GFP

a.k.a. fuGFP

fuGFP is non-patented variant of GFP. It has 76% amino acid identity to GFPmut3, and is thus safely out­side the claim of the sfGFP patent. It maintains the superfolder mutations, and is thus fast-folding and very bright. fuGFP absorbs light best in the long-wave UV (not blue like sfGFP).

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? <add one> 27.0 kDa -

FPbase ID: 7BLNH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
395 503 27,618          

Photostability

No photostability measurements available ... add one!

Free Use GFP Sequence

MVSSGEDIFSGLVPILIELEGDVNGHRFSVRGEGYGDASNGKLEIKFICTTGRLPVPWPTLVTTLSYGVQCFAKYPEHMRQNDFFKSAMPDGYVQERTISFKEDGTYKTRAEVKFEGEALVNRIDLKGLEFKEDGNILGHKLEYSFNSHYVYITADKNRNGLEAQFRIRHNVDDGSVQLADHYQQNTPIGEGPVLLPEQHYLTTNSVLSKDPQERRDHMVLVEFVTAAGLSLGMDELYK

Excerpts

No excerpts have been added for Free Use GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Development of a whole‐cell biosensor for ethylene oxide and ethylene

    Moratti Cf, Yang Snn, Scott C, Coleman Nv

    (2024). Microbial Biotechnology, 17(6) , e14511. doi: 10.1111/1751-7915.14511. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change