compare

Comparison List

FPrfl2.3

FPrfl2.3 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2004, derived from Ricordea florida.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Ricordea florida kDa -

FPbase ID: 7HX6W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
506 512          

Photostability

No photostability measurements available ... add one!

FPrfl2.3 Sequence

MNALQEEMKIKLTMVGVVNGQSFKIDGKGKGKPYEGSQELTLKVVEGGPLLFSYDILTTIFQYGNRAFVNYPKDIPDIFKQTCSGLDGGYSWQRTMTYEDGGVCTATSNVSVVGDTFNYEIHFMGANFPPNGPVMQKRTVKWEPSXEIXFERDGLLRGDVPMSLLLKGGDHYRCDFKTIYKPNKKVKLPGYHFVDHCIEIKSQENDYNMVALFEDAVAHYSPLEKKSQAKA
GenBank: AAK71340
UniProtKB: Q8MU46
IPG: 1249357

Excerpts

No excerpts have been added for FPrfl2.3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cloning of anthozoan fluorescent protein genes

Carter Rw, Schmale Mc, Gibbs Pdl

(2004). Comparative Biochemistry and Physiology Part C: Toxicology & Pharmacology, 138(3) , 259-270. doi: 10.1016/j.cca.2004.07.002. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change