compare

Comparison List

FPmcavgr7.7

FPmcavgr7.7 is a fluorescent protein published in 2004, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Montastraea cavernosa kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

FPmcavgr7.7 Sequence

MTSVAQEKGVIKPDMKMKLRMEGAVNGHKFVIEGDGKGKPFDGTQTMDLTVIEGAPLPFAYAILTTVFDYGNRVFAKYPEDIADYFKQTFPEGYFWERSMTYEDQGICIATNDITMMKGVDDCFVYKIRFDGVNFPANGPVMQRKTLKWEPSTEKMYXRDGVLKGDVNMALLLEGGGHYRXDXKTTYRAKKVVQLPDYHFVDHRIEIVSHDKDYNKVKLYEHAEAHSGLPRQAK
GenBank: AAK71334
UniProtKB: Q8MU47
IPG: 220476

Excerpts

No excerpts have been added for FPmcavgr7.7
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cloning of anthozoan fluorescent protein genes

Carter Rw, Schmale Mc, Gibbs Pdl

(2004). Comparative Biochemistry and Physiology Part C: Toxicology & Pharmacology, 138(3) , 259-270. doi: 10.1016/j.cca.2004.07.002. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change