compare

Comparison List

Fpag_frag

Fpag_frag is a fluorescent protein published in 2004, derived from Agaricia fragilis.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Agaricia fragilis 30.0 kDa -

FPbase ID: 5W635

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Fpag_frag Sequence

MAISTLKNVIIIVIIYSCSTCAVWSNSNSESSFTNGIAEEMKTRVHLEGTVNGHSFTIKGEGRGYPYKGEQFMSLEVVNGAPLPFSFDILTPAFMYGNRVFTKYPPNIPDYFKQTFPEGYHWERNIPFEDQAACTVTSHIRLEEEERRFVNNVRFHCVNFPPNGPVMQRRILKWEPSTENIYPRDGFLEGHVDMTLRVEGGGYYRAEFKSTYKGKTPVRDMPDFHFIDHRIEITEHDEDYTNVELHDVSWARYSMLPTM
GenBank: AAK71331
UniProtKB: Q8MMA2
IPG: 590298

Excerpts

No excerpts have been added for Fpag_frag
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cloning of anthozoan fluorescent protein genes

Carter Rw, Schmale Mc, Gibbs Pdl

(2004). Comparative Biochemistry and Physiology Part C: Toxicology & Pharmacology, 138(3) , 259-270. doi: 10.1016/j.cca.2004.07.002. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change