compare

Comparison List

FAST

a.k.a. Fluorescence- Activating and absorption-Shifting Tag

FAST is a fluorescent protein published in 2015, derived from Halorhodospira halophila. It is reported to be a monomer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Halorhodospira halophila 13.7 kDa -

FPbase ID: 6F9LH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
             
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

FAST Sequence

BLAST
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFKEGVASGNLNTMFEWMIPTSRGPTKVKVHMKKALSGDSYWVFVKRV

Excerpts

No excerpts have been added for FAST
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Small fluorescence-activating and absorption-shifting tag for tunable protein imaging in vivo

Plamont M-A, Billon-Denis E, Maurin S, Gauron C, Pimenta Fm, Specht Cg, Shi J, Quérard J, Pan B, Rossignol J, Moncoq K, Morellet N, Volovitch M, Lescop E, Chen Y, Triller A, Vriz S, Le Saux T, Jullien L, Gautier A

(2015). Proceedings of the National Academy of Sciences, 113(3) , 497-502. doi: 10.1073/pnas.1513094113. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change