compare

Comparison List

fabdGFP

fabdGFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2008, derived from Favites abdita.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Favites abdita 25.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
508 520 116,800 0.54 63.07      

Photostability

no photostability measurements available ... add one!

fabdGFP Sequence

MSVIKPDMKIKLRMEGAVNGHKFAIEGEGKGQPFQGKQTMNLKVKEGGPLPFAYDILTTIFNYGNRVFAKYPDDIVDYFKQSFPEGYSWERSMTYEDGGICIATNDITLDGDCFVYKIRFDGVNFPAKSPVLQKKTQKWEPSTEKLYVRDGLLKGDVNMALLLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHCIEIVSHDKDYNNVKLCEHAEAHSGLPKEAK
GenBank: ACD13193
UniProtKB: B6CTZ4
IPG: 14926074

Excerpts

No excerpts have been added for fabdGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change