compare

Comparison List

eqFP611 V124T

eqFP611 V124T is a basic (constitutively fluorescent) red fluorescent protein published in 2005, derived from Entacmaea quadricolor. It is reported to be a very slowly-maturing dimer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.1 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
559 611 74,000 0.42 31.08   450.0  

Photostability

no photostability measurements available ... add one!

eqFP611 V124T Sequence

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGTNFPSNGAVMQKKTKGWEPNTEMLYPADGGLRGYSQMALNVDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for eqFP611 V124T
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change