compare

Comparison List

Enhanced Cyan-Emitting GFP

Enhanced Cyan-Emitting GFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2002, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 25.7 kDa -

FPbase ID: R3OET

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
458 485          

Photostability

No photostability measurements available ... add one!

Enhanced Cyan-Emitting GFP Sequence

MSKGEELFTGVVPILVELDGDVNGHRFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKAHFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAG

Structure

Deposited: ,
Chromophore (TWG):

Excerpts

No excerpts have been added for Enhanced Cyan-Emitting GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change