compare

Comparison List

eGFP205C

eGFP205C is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
489 509          

Photostability

no photostability measurements available ... add one!

eGFP205C Sequence

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQCALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore (TYG):

Excerpts

No excerpts have been added for eGFP205C
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change