compare

Comparison List

eechRFP

eechRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Echinophyllia echinata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Echinophyllia echinata 25.6 kDa -

FPbase ID: JB7SD

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
574 582 12,100 0.43 5.2      

Photostability

No photostability measurements available ... add one!

eechRFP Sequence

MSLINPEMKIKLLMEGNVNGHPFVIEGDGKGHPFEGKQSMDLVVKEGAPLPFAYDILTTAFHYGNRVFAKYPDHIPDYFKQSFPNGFSWERSLMFEDGGVCIATNDITLEGDTFFNKVRFYGVNFPPNGPVMQKKTLKWEASTEKMYLRDGVLTGDITMALLLKGDVHYRCDFRTTYKSRQEGVKLPGYHFVDHCISIVSHDKDYTKVKLYEHAVAHLGLPENVK
GenBank: ABB17960
UniProtKB: A8CLS2
IPG: 4901527

Excerpts

No excerpts have been added for eechRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change