compare

Comparison List

echFP

echFP is a fluorescent protein published in 2009, derived from Scleractinia sp. Lizard Island 28.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Scleractinia sp. Lizard Island 28 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

echFP Sequence

MNVIKTDMKMKLRMVGAVNGHKFEIAGEGKGKPFEGKQTMNLEVLVGGPLPFAFDILTTVFDYGNRVFVKYPKDIXBYFKQSFPEGFSWERSMAYEDGGICIXTNBITLMKGDCFLYEIRFDGVNFPANSPVXQKXTVKWEPSTEKLYVRDGVLKGDVNMALLLEEGGHYRCDFKTTYKSKKVVQLPDYHFVDHRIEIESHDKDYNKVKLCEHAEAHSGLPRQAK
GenBank: ACV52373
UniProtKB: D1KWT0
IPG: 18466445

Excerpts

No excerpts have been added for echFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Novel Internal Regions of Fluorescent Proteins Undergo Divergent Evolutionary Patterns

Gruber Df, Desalle R, Lienau Ek, Tchernov D, Pieribone Va, Kao H-T

(2009). Molecular Biology and Evolution, 26(12) , 2841-2848. doi: 10.1093/molbev/msp194. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change